# Anti-JHDM1D Antibody

**Cod produs:** A92411 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-JHDM1D Antibody este un anticorp policlonal de iepure împotriva țintei JHDM1D, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | JHDM1D |
| Applications | WB, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 106 kDa |
| Antigen species | Mouse |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ |
| Imunogen | A recombinant fusion protein corresponding to amino acids 100-200 of mouse JHDM1D. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A92411-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to JHDM1D.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/92/A92411.pdf)

---

Sursă: https://reactivi.ro/produs/anti-jhdm1d-antibody-2/ · actualizat 9 septembrie 2026