# Anti-Isoleucyl tRNA synthetase Antibody

**Cod produs:** A8547 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Isoleucyl tRNA synthetase Antibody este un anticorp policlonal de iepure împotriva țintei Isoleucyl tRNA Synthetase, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Isoleucyl tRNA Synthetase |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:100 |
| Molecular weight | 144 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A8547-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Isoleucyl tRNA synthetase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/8/A8547.pdf)

---

Sursă: https://reactivi.ro/produs/anti-isoleucyl-trna-synthetase-antibody/ · actualizat 9 septembrie 2026