# Anti-Interferon alpha 2 Antibody

**Cod produs:** A58353 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Interferon alpha 2 Antibody este un anticorp policlonal de iepure împotriva țintei Interferon alpha 2, cu reactivitate declarată pentru Human. Este validat pentru ELISA, WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimile 5µg, 20µg și 100µg, la prețuri între 1.963,23 și 5.324,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Interferon alpha 2 |
| Applications | ELISA, WB |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purification | Protein G chromatography. |
| Isotype | IgG |
| Recommended dilutions | ELISA: at least 1/500, allows the detection of 0.2-1 ng/well of human Interferon a 2a, WB: 1/1,000. |
| Purity | >98% as determined by SDS-PAGE. |
| Antigen species | Human |
| Reconstitution | Reconstitute with sterile water. Mix gently, wash the sides of the vial and wait 30-60 seconds before use. |
| Storage | Shipped at 4°C. Long term store working aliquots at -20°C. Avoid freeze/thaw cycles. |
| Secvență | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Imunogen | Recombinant Human Interferon a 2a expressed in plants. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A58353-5 · 1.963,23 lei |
| 20µg | A58353-20 · 2.628,73 lei |
| 100µg | A58353-100 · 5.324,00 lei |

## Descriere

Rabbit polyclonal antibody to Interferon alpha 2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/58/A58353.pdf)

---

Sursă: https://reactivi.ro/produs/anti-interferon-alpha-2-antibody-2/ · actualizat 9 septembrie 2026