# Anti-Integrin beta 3 Antibody \[ARC0460\]

**Cod produs:** A305528 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Integrin beta 3 Antibody [ARC0460] este un anticorp monoclonal de iepure împotriva țintei Integrin beta 3, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, IP, Flow Cytometry, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Integrin beta 3 |
| Applications | WB, IHC, IP, Flow Cytometry |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:500-1:1,000, Flow Cytometry: 1:50-1:200 |
| Molecular weight | 110 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC0460 |
| Secvență | CVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 689-788 of human Integrin beta 3 (ITGB3/CD61) (P05106). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305528-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC0460] antibody to Integrin beta 3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305528.pdf)

---

Sursă: https://reactivi.ro/produs/anti-integrin-beta-3-antibody-arc0460/ · actualizat 9 septembrie 2026