# Anti-Integrin alpha V Antibody

**Cod produs:** A13861 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Integrin alpha V Antibody este un anticorp policlonal de iepure împotriva țintei Integrin alpha V, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, IP, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Integrin alpha V |
| Applications | WB, IHC, IP |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000, IHC: 1:50-1:200, IP: 1:1,000-1:5,000 |
| Molecular weight | 130 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | LKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 950 to the C-terminus of human Integrin alpha V (ITGAV/CD51) (NP_002201.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A13861-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Integrin alpha V.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/13/A13861.pdf)

---

Sursă: https://reactivi.ro/produs/anti-integrin-alpha-v-antibody/ · actualizat 9 septembrie 2026
