# Anti-INPP1 Antibody

**Cod produs:** A11301 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-INPP1 Antibody este un anticorp policlonal de iepure împotriva țintei INPP1, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | INPP1 |
| Applications | WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 44 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQ |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human INPP1 (NP_002185.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A11301-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to INPP1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/11/A11301.pdf)

---

Sursă: https://reactivi.ro/produs/anti-inpp1-antibody/ · actualizat 9 septembrie 2026
