# Anti-Indoleamine 2, 3-dioxygenase Antibody \[10.1\]

**Cod produs:** A278711 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Indoleamine 2, 3-dioxygenase Antibody [10.1] este un anticorp monoclonal de șoarece împotriva țintei Indoleamine 2, 3-dioxygenase, cu reactivitate declarată pentru Human, Mouse. Este validat pentru IHC-Fr, WB, are izotipul IgG3 și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 5.623,48 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Indoleamine 2, 3-dioxygenase |
| Applications | IHC-Fr, WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with 0.1% Sodium Azide. |
| Host | Mouse |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Isotype | IgG3 |
| Molecular weight | 45 kDa in IFN-gamma treated human cell lines. This antibody recognizes a slightly lower molecular weight band in Mouse IDO compared to its human counterpart. |
| Protein Length | 107 |
| Storage | Shipped at ambient temperature. Upon delivery aliquot and store at 4°C. |
| Clonă | 10.1 |
| Secvență | LARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTV |
| Imunogen | A peptide corresponding to amino acids 78-184 of human IDO fused to GST. |
| Aminoacizi | aa 78 - 184 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A278711-100 · 5.623,48 lei |

## Descriere

Mouse monoclonal [10.1] antibody to Indoleamine 2, 3-dioxygenase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/278/A278711.pdf)

---

Sursă: https://reactivi.ro/produs/anti-indoleamine-2-3-dioxygenase-antibody-10-1/ · actualizat 9 septembrie 2026
