# Anti-IL-21 Antibody

**Cod produs:** A283234 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-IL-21 Antibody este un anticorp policlonal de capră împotriva țintei IL-21, cu reactivitate declarată pentru Human. Este validat pentru IHC-P, ELISA, ICC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 50µg, la prețul de 3.826,63 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-21 |
| Applications | IHC-P, ELISA, ICC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide. |
| Host | Goat |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Isotype | IgG |
| Recommended dilutions | ELISA: 1:50,000 |
| Protein Length | 29 |
| Storage | Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use. |
| Secvență | C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE |
| Imunogen | Synthetic peptide sequence C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminus of human IL-21. |
| Aminoacizi | aa 40 - 68 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A283234-50 · 3.826,63 lei |

## Descriere

Goat polyclonal antibody to IL-21.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/283/A283234.pdf)

---

Sursă: https://reactivi.ro/produs/anti-il-21-antibody-3/ · actualizat 9 septembrie 2026