# Anti-IFN gamma Antibody \[ARC52882\]

**Cod produs:** A329461 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-IFN gamma Antibody [ARC52882] este un anticorp monoclonal de iepure împotriva țintei IFN gamma, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IFN gamma |
| Applications | WB, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:2,000-1:6,000, ELISA: 1 µg/ml (starting concentration) |
| Molecular weight | 17 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC52882 |
| Secvență | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG |
| Imunogen | A recombinant fusion protein corresponding to amino acids 24-161 of human IFN gamma. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329461-100 · 2.861,65 lei |

## Descriere

Rabbit monoclonal [ARC52882] antibody to IFN gamma.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329461.pdf)

---

Sursă: https://reactivi.ro/produs/anti-ifn-gamma-antibody-arc52882/ · actualizat 9 septembrie 2026
