# Anti-Hyaluronan synthase 2 Antibody

**Cod produs:** A12414 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Hyaluronan synthase 2 Antibody este un anticorp policlonal de iepure împotriva țintei Hyaluronan Synthase 2, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Hyaluronan Synthase 2 |
| Applications | WB |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:100-1:500 |
| Molecular weight | 64 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQ |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 67-185 of human HAS2 (NP_005319.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A12414-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Hyaluronan synthase 2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/12/A12414.pdf)

---

Sursă: https://reactivi.ro/produs/anti-hyaluronan-synthase-2-antibody/ · actualizat 9 septembrie 2026