# Anti-Human IgG Antibody \[ARC2243\]

**Cod produs:** A309060 · **Brand:** Antibodies · **Categorie:** Anticorpi secundari

Anti-Human IgG Antibody [ARC2243] este un anticorp monoclonal de iepure împotriva țintei Human IgG, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.828,38 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Human IgG |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000 |
| Molecular weight | 60 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2243 |
| Secvență | VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IgG3 (P01860). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A309060-100 · 2.828,38 lei |

## Descriere

Rabbit monoclonal [ARC2243] antibody to Human IgG.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/309/A309060.pdf)

---

Sursă: https://reactivi.ro/produs/anti-human-igg-antibody-arc2243/ · actualizat 9 septembrie 2026