# Anti-Human Coronavirus Spike glycoprotein Antibody

**Cod produs:** A308892 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Human Coronavirus Spike glycoprotein Antibody este un anticorp policlonal de iepure împotriva țintei Human Coronavirus Spike glycoprotein, cu reactivitate declarată pentru HCoV-229E. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Human Coronavirus Spike glycoprotein |
| Applications | WB |
| Reactivity | HCoV-229E |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 160 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus Spike S1 (NP_073551.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308892-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Human Coronavirus Spike glycoprotein.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308892.pdf)

---

Sursă: https://reactivi.ro/produs/anti-human-coronavirus-spike-glycoprotein-antibody-5/ · actualizat 9 septembrie 2026
