# Anti-HP1 gamma/CBX3 (methyl His175) Antibody

**Cod produs:** A307038 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-HP1 gamma/CBX3 (methyl His175) Antibody este un anticorp policlonal de iepure împotriva țintei HP1 gamma/CBX3, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | HP1 gamma/CBX3 |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/CBX3 (NP_009207.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A307038-100 · 3.094,58 lei |

## Descriere

Rabbit polyclonal antibody to HP1 gamma/CBX3 (methyl His175).

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/307/A307038.pdf)

---

Sursă: https://reactivi.ro/produs/anti-hp1-gamma-cbx3-methyl-his175-antibody/ · actualizat 9 septembrie 2026