# Anti-GPCR RDC1/CXCR-7 Antibody \[ARC1374\]

**Cod produs:** A309021 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-GPCR RDC1/CXCR-7 Antibody [ARC1374] este un anticorp monoclonal de iepure împotriva țintei GPCR RDC1/CXCR-7, cu reactivitate declarată pentru Human. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GPCR RDC1/CXCR-7 |
| Applications | WB |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 38 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1374 |
| Secvență | VCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 263-362 of human CXCR7 (P25106). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A309021-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1374] antibody to GPCR RDC1/CXCR-7.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/309/A309021.pdf)

---

Sursă: https://reactivi.ro/produs/anti-gpcr-rdc1-cxcr-7-antibody-arc1374/ · actualizat 9 septembrie 2026