# Anti-GPCR GPR120 Antibody

**Cod produs:** A309176 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-GPCR GPR120 Antibody este un anticorp policlonal de iepure împotriva țintei GPCR GPR120, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | GPCR GPR120 |
| Applications | WB, ELISA |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 42 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | WTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPT |
| Imunogen | A synthetic peptide corresponding to amino acids 100-200 of human GPCR GPR120. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A309176-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to GPCR GPR120.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/309/A309176.pdf)

---

Sursă: https://reactivi.ro/produs/anti-gpcr-gpr120-antibody-5/ · actualizat 9 septembrie 2026