# Anti-Glutathione Peroxidase 1 Antibody \[ARC53251\]

**Cod produs:** A329406 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Glutathione Peroxidase 1 Antibody [ARC53251] este un anticorp monoclonal de iepure împotriva țintei Glutathione Peroxidase 1, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Glutathione Peroxidase 1 |
| Applications | WB, ELISA |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:12,000-1:72,000, IHC 1:50-200, ELISA: 1 µg/ml (starting concentration) |
| Molecular weight | 22kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC53251 |
| Secvență | GGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA |
| Imunogen | A recombinant fusion protein corresponding to amino acids 103-203 of human Glutathione Peroxidase 1. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329406-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC53251] antibody to Glutathione Peroxidase 1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329406.pdf)

---

Sursă: https://reactivi.ro/produs/anti-glutathione-peroxidase-1-antibody-arc53251/ · actualizat 9 septembrie 2026