# Anti-Glutamyl Prolyl tRNA synthetase/PARS Antibody

**Cod produs:** A88615 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Glutamyl Prolyl tRNA synthetase/PARS Antibody este un anticorp policlonal de iepure împotriva țintei Glutamyl Prolyl tRNA synthetase/PARS, cu reactivitate declarată pentru Human. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Glutamyl Prolyl tRNA synthetase/PARS |
| Applications | WB, IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IHC: 1:50-1:100 |
| Molecular weight | 190 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A88615-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Glutamyl Prolyl tRNA synthetase/PARS.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/88/A88615.pdf)

---

Sursă: https://reactivi.ro/produs/anti-glutamyl-prolyl-trna-synthetase-pars-antibody/ · actualizat 9 septembrie 2026