# Anti-Glucose Transporter GLUT2 Antibody

**Cod produs:** A16352 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Glucose Transporter GLUT2 Antibody este un anticorp policlonal de iepure împotriva țintei Glucose Transporter GLUT2, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Glucose Transporter GLUT2 |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:100-1:500 |
| Molecular weight | 38 - 45 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT2/GLUT2/SLC2A2 (NP_000331.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A16352-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Glucose Transporter GLUT2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/16/A16352.pdf)

---

Sursă: https://reactivi.ro/produs/anti-glucose-transporter-glut2-antibody/ · actualizat 9 septembrie 2026