# Anti-Glucocorticoid Receptor Antibody \[ARC0062\]

**Cod produs:** A305646 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Glucocorticoid Receptor Antibody [ARC0062] este un anticorp monoclonal de iepure împotriva țintei Glucocorticoid Receptor, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IP, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Glucocorticoid Receptor |
| Applications | WB, IP |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IP: 1:500-1:1,000 |
| Molecular weight | 95 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC0062 |
| Secvență | DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2-180 of human GR (P04150). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305646-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC0062] antibody to Glucocorticoid Receptor.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305646.pdf)

---

Sursă: https://reactivi.ro/produs/anti-glucocorticoid-receptor-antibody-arc0062/ · actualizat 9 septembrie 2026
