# Anti-FGF2 Antibody \[ARC51103\]

**Cod produs:** A329369 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-FGF2 Antibody [ARC51103] este un anticorp monoclonal de iepure împotriva țintei FGF2, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, ICC/IF, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | FGF2 |
| Applications | WB, ICC/IF, ELISA |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:2,000, ICC/IF: 1:50-1:200, ELISA: 1 µg/ml (starting concentration) |
| Molecular weight | 18 kDa / 22 kDa / 26 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC51103 |
| Secvență | RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE |
| Imunogen | A synthetic peptide corresponding to amino acids 100-200 of human FGF2. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329369-100 · 2.861,65 lei |

## Descriere

Rabbit monoclonal [ARC51103] antibody to FGF2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329369.pdf)

---

Sursă: https://reactivi.ro/produs/anti-fgf2-antibody-arc51103/ · actualizat 9 septembrie 2026
