# Anti-Ferritin Heavy Chain Antibody \[ARC2665\]

**Cod produs:** A308297 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Ferritin Heavy Chain Antibody [ARC2665] este un anticorp monoclonal de iepure împotriva țintei Ferritin Heavy Chain, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Ferritin Heavy Chain |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2665 |
| Secvență | QDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 84-183 of human Ferritin Heavy Chain (P02794). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308297-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2665] antibody to Ferritin Heavy Chain.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308297.pdf)

---

Sursă: https://reactivi.ro/produs/anti-ferritin-heavy-chain-antibody-arc2665/ · actualizat 9 septembrie 2026