# Anti-ETV1 Antibody \[ARC60301\]

**Cod produs:** A329350 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-ETV1 Antibody [ARC60301] este un anticorp monoclonal de iepure împotriva țintei ETV1, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IP, ChIP, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | ETV1 |
| Applications | WB, IP, ChIP, ELISA |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IP: 0.5µg-4µg antibody for 400µg-800µg extracts of whole cells, ELISA: 1 µg/ml (starting concentration), ChIP: 5µg antibody for 10µg-15µg of Chromatin |
| Molecular weight | 55 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC60301 |
| Secvență | MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEIS |
| Imunogen | A synthetic peptide corresponding to amino acids 1-100 of human ETV1. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329350-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC60301] antibody to ETV1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329350.pdf)

---

Sursă: https://reactivi.ro/produs/anti-etv1-antibody-arc60301/ · actualizat 9 septembrie 2026