# Anti-Estrogen Related Receptor beta Antibody

**Cod produs:** A90193 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Estrogen Related Receptor beta Antibody este un anticorp policlonal de iepure împotriva țintei Estrogen Related Receptor beta, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Estrogen Related Receptor beta |
| Applications | WB, ELISA |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration) |
| Molecular weight | 56 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | VYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLR |
| Imunogen | A synthetic peptide corresponding to amino acids 300-400 of human Estrogen Related Receptor beta. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A90193-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Estrogen Related Receptor beta.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/90/A90193.pdf)

---

Sursă: https://reactivi.ro/produs/anti-estrogen-related-receptor-beta-antibody-2/ · actualizat 9 septembrie 2026