# Anti-ENPEP Antibody

**Cod produs:** A87839 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-ENPEP Antibody este un anticorp policlonal de iepure împotriva țintei ENPEP, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | ENPEP |
| Applications | WB, ELISA |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 109 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | VFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWF |
| Imunogen | A synthetic peptide corresponding to amino acids 850-950 of human ENPEP. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A87839-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to ENPEP.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/87/A87839.pdf)

---

Sursă: https://reactivi.ro/produs/anti-enpep-antibody-2/ · actualizat 9 septembrie 2026