# Anti-ELOVL6/LCE Antibody

**Cod produs:** A306651 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-ELOVL6/LCE Antibody este un anticorp policlonal de iepure împotriva țintei ELOVL6/LCE, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | ELOVL6/LCE |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 30 kDa / 45 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | LMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLL |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306651-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to ELOVL6/LCE.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306651.pdf)

---

Sursă: https://reactivi.ro/produs/anti-elovl6-lce-antibody/ · actualizat 9 septembrie 2026
