# Anti-DOT1L Antibody

**Cod produs:** A12763 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-DOT1L Antibody este un anticorp policlonal de iepure împotriva țintei DOT1L, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, IF, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | DOT1L |
| Applications | WB, IHC, IF |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2000, IHC: 1:50-1:200, IF: 1:50-1:200 |
| Molecular weight | 170kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | TDKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLSGPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human DOT1L (NP_115871.1). |
| Aminoacizi | 101 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A12763-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to DOT1L.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/12/A12763.pdf)

---

Sursă: https://reactivi.ro/produs/anti-dot1l-antibody/ · actualizat 9 septembrie 2026
