# Anti-Dopamine beta Hydroxylase Antibody \[ARC3095\]

**Cod produs:** A329322 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Dopamine beta Hydroxylase Antibody [ARC3095] este un anticorp monoclonal de iepure împotriva țintei Dopamine beta Hydroxylase, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Dopamine beta Hydroxylase |
| Applications | WB, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration) |
| Molecular weight | 75 - 80 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC3095 |
| Secvență | LVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYE |
| Imunogen | A recombinant fusion protein corresponding to amino acids 100-250 of human Dopamine beta Hydroxylase. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329322-100 · 2.861,65 lei |

## Descriere

Rabbit monoclonal [ARC3095] antibody to Dopamine beta Hydroxylase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329322.pdf)

---

Sursă: https://reactivi.ro/produs/anti-dopamine-beta-hydroxylase-antibody-arc3095/ · actualizat 9 septembrie 2026