# Anti-Dihydrofolate reductase (DHFR) Antibody \[ARC1513\]

**Cod produs:** A306177 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Dihydrofolate reductase (DHFR) Antibody [ARC1513] este un anticorp monoclonal de iepure împotriva țintei Dihydrofolate reductase (DHFR), cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Dihydrofolate reductase (DHFR) |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 20 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1513 |
| Secvență | HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 88-187 of human DHFR (P00374). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306177-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1513] antibody to Dihydrofolate reductase (DHFR).

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306177.pdf)

---

Sursă: https://reactivi.ro/produs/anti-dihydrofolate-reductase-dhfr-antibody-arc1513/ · actualizat 9 septembrie 2026