# Anti-Cytokeratin 8 Antibody

**Cod produs:** A329307 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Cytokeratin 8 Antibody este un anticorp policlonal de iepure împotriva țintei Cytokeratin 8, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Cytokeratin 8 |
| Applications | WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 62 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | VKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV |
| Imunogen | A synthetic peptide corresponding to amino acids 380-480 of human Cytokeratin 8. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329307-100 · 3.094,58 lei |

## Descriere

Rabbit polyclonal antibody to Cytokeratin 8.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329307.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cytokeratin-8-antibody-3/ · actualizat 9 septembrie 2026
