# Anti-Cytokeratin 19 Antibody \[ARC0272\]

**Cod produs:** A308569 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Cytokeratin 19 Antibody [ARC0272] este un anticorp monoclonal de iepure împotriva țintei Cytokeratin 19, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Cytokeratin 19 |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC0272 |
| Secvență | RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (P08727). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308569-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC0272] antibody to Cytokeratin 19.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308569.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cytokeratin-19-antibody-arc0272/ · actualizat 9 septembrie 2026