# Anti-CTNNA3 Antibody \[ARC2463\]

**Cod produs:** A305581 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-CTNNA3 Antibody [ARC2463] este un anticorp monoclonal de iepure împotriva țintei CTNNA3, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CTNNA3 |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IHC: 1:50-1:200 |
| Molecular weight | 100 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2463 |
| Secvență | DIIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-895 of human CTNNA3 (Q9UI47). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305581-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2463] antibody to CTNNA3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305581.pdf)

---

Sursă: https://reactivi.ro/produs/anti-ctnna3-antibody-arc2463/ · actualizat 9 septembrie 2026