# Anti-COL4A2 Antibody \[ARC62585\]

**Cod produs:** A329271 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-COL4A2 Antibody [ARC62585] este un anticorp monoclonal de iepure împotriva țintei COL4A2, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, ELISA, Dot Blot, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | COL4A2 |
| Applications | WB, ELISA, Dot Blot |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:6,000, Dot Blot: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration) |
| Molecular weight | 170-185 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC62585 |
| Secvență | AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS |
| Imunogen | A recombinant fusion protein corresponding to amino acids 1573-1690 of human COL4A2. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329271-100 · 2.861,65 lei |

## Descriere

Rabbit monoclonal [ARC62585] antibody to COL4A2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329271.pdf)

---

Sursă: https://reactivi.ro/produs/anti-col4a2-antibody-arc62585/ · actualizat 9 septembrie 2026