# Anti-Choriogonadotropin subunit beta 3 Antibody

**Cod produs:** A9890 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Choriogonadotropin subunit beta 3 Antibody este un anticorp policlonal de iepure împotriva țintei Choriogonadotropin Subunit beta 3, cu reactivitate declarată pentru Human. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Choriogonadotropin Subunit beta 3 |
| Applications | WB |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 20 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | ASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-165 of human CGB5 (NP_000728.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A9890-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Choriogonadotropin subunit beta 3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/9/A9890.pdf)

---

Sursă: https://reactivi.ro/produs/anti-choriogonadotropin-subunit-beta-3-antibody/ · actualizat 9 septembrie 2026