# Anti-CHMP1A Antibody

**Cod produs:** A80689 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-CHMP1A Antibody este un anticorp policlonal de iepure împotriva țintei CHMP1A, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CHMP1A |
| Applications | WB, ELISA |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 35 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN |
| Imunogen | A recombinant fusion protein corresponding to amino acids 1-196 of human CHMP1A. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A80689-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to CHMP1A.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/80/A80689.pdf)

---

Sursă: https://reactivi.ro/produs/anti-chmp1a-antibody-2/ · actualizat 9 septembrie 2026
