# Anti-Cellular Apoptosis Susceptibility/CSE1L Antibody \[ARC1856\]

**Cod produs:** A306604 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Cellular Apoptosis Susceptibility/CSE1L Antibody [ARC1856] este un anticorp monoclonal de iepure împotriva țintei Cellular Apoptosis Susceptibility/CSE1L, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Cellular Apoptosis Susceptibility/CSE1L |
| Applications | WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 105 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1856 |
| Secvență | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306604-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1856] antibody to Cellular Apoptosis Susceptibility/CSE1L.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306604.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cellular-apoptosis-susceptibility-cse1l-antibody-arc1856/ · actualizat 9 septembrie 2026