# Anti-Cdk9 Antibody \[ARC0527\]

**Cod produs:** A81021 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Cdk9 Antibody [ARC0527] este un anticorp monoclonal de iepure împotriva țintei Cdk9, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, ICC/IF, IP, ChIP, ChIP-seq, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Cdk9 |
| Applications | WB, IHC, ICC/IF, IP, ChIP, ChIP-seq |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, ChIP: 1:50-1:200, ChIP-seq: 2-4µg/IP, CUT&Tag: 16 cells/5µg |
| Molecular weight | 42 kDa / 55 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC0527 |
| Secvență | RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CDK9 (P50750). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A81021-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC0527] antibody to Cdk9.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/81/A81021.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cdk9-antibody-arc0527/ · actualizat 9 septembrie 2026