# Anti-CDH4 Antibody

**Cod produs:** A13958 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-CDH4 Antibody este un anticorp policlonal de iepure împotriva țintei CDH4, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CDH4 |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:2,000 |
| Molecular weight | 100 - 115kDa (Observed MW) |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | KRREKERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPGDIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMYGGGEED |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 757-916 of human CDH4 (NP_001785.2). |
| Aminoacizi | 160 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A13958-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to CDH4.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/13/A13958.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cdh4-antibody/ · actualizat 9 septembrie 2026
