# Anti-CD8 alpha Antibody \[ARC55249\]

**Cod produs:** A308777 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-CD8 alpha Antibody [ARC55249] este un anticorp monoclonal de iepure împotriva țintei CD8 alpha, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD8 alpha |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC55249 |
| Secvență | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308777-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC55249] antibody to CD8 alpha.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308777.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cd8-alpha-antibody-arc55249/ · actualizat 9 septembrie 2026