# Anti-CD48 Antibody \[ARC53030\]

**Cod produs:** A308320 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-CD48 Antibody [ARC53030] este un anticorp monoclonal de iepure împotriva țintei CD48, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, Flow Cytometry, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD48 |
| Applications | WB, Flow Cytometry |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:2,000-1:20,000, Flow Cytometry: 1:50-1:200 |
| Molecular weight | 46 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC53030 |
| Secvență | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48 (NP_001769.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308320-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC53030] antibody to CD48.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308320.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cd48-antibody-arc53030/ · actualizat 9 septembrie 2026