# Anti-CD35 Antibody \[ARC2065\]

**Cod produs:** A305576 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-CD35 Antibody [ARC2065] este un anticorp monoclonal de iepure împotriva țintei CD35, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru IHC, ICC/IF, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CD35 |
| Applications | IHC, ICC/IF |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200, ICC/IF: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2065 |
| Secvență | DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305576-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2065] antibody to CD35.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305576.pdf)

---

Sursă: https://reactivi.ro/produs/anti-cd35-antibody-arc2065/ · actualizat 9 septembrie 2026