# Anti-BRG1 Antibody \[5B7\]

**Cod produs:** A320277 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-BRG1 Antibody [5B7] este un anticorp monoclonal de șobolan împotriva țintei BRG1, cu reactivitate declarată pentru Human, Mouse, Monkey. Este validat pentru IF, WB, are izotipul IgG2a și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 5.556,93 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | BRG1 |
| Applications | IF, WB |
| Reactivity | Human, Mouse, Monkey |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with 0.035% Sodium Azide and 30% Glycerol. |
| Host | Rat |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Purification | Protein G affinity chromatography of tissue culture supernatant. |
| Isotype | IgG2a |
| Recommended dilutions | IF: 2 µg/ml - 10 µg/ml, WB: 0.5 µg/ml - 2 µg/ml |
| Protein Length | 83 |
| Clonă | 5B7 |
| Secvență | MQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAP |
| Imunogen | A recombinant protein corresponding to amino acids 213-295 of human SMARCA4. |
| Aminoacizi | aa 213 - 295 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A320277-100 · 5.556,93 lei |

## Descriere

Rat monoclonal [5B7] antibody to BRG1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/320/A320277.pdf)

---

Sursă: https://reactivi.ro/produs/anti-brg1-antibody-5b7/ · actualizat 9 septembrie 2026