# Anti-Bcl-2 Antibody

**Cod produs:** A329147 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Bcl-2 Antibody este un anticorp policlonal de iepure împotriva țintei Bcl 2, cu reactivitate declarată pentru Mouse. Este validat pentru WB, IP, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Bcl 2 |
| Applications | WB, IP, ELISA |
| Reactivity | Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000, IP: 0.5µg-4µg antibody for 400µg-600µg extracts of whole cells |
| Molecular weight | 26 kDa |
| Antigen species | Rat |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD |
| Imunogen | A synthetic peptide corresponding to amino acids 1-100 of rat Bcl-2. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329147-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Bcl-2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329147.pdf)

---

Sursă: https://reactivi.ro/produs/anti-bcl-2-antibody-8/ · actualizat 9 septembrie 2026
