# Anti-ATP6V0C Antibody \[ARC61235\]

**Cod produs:** A329135 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-ATP6V0C Antibody [ARC61235] este un anticorp monoclonal de iepure împotriva țintei ATP6V0C, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | ATP6V0C |
| Applications | WB, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 16 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC61235 |
| Secvență | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG |
| Imunogen | A synthetic peptide corresponding to amino acids 1-100 of human ATP6V0C. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329135-100 · 2.861,65 lei |

## Descriere

Rabbit monoclonal [ARC61235] antibody to ATP6V0C.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329135.pdf)

---

Sursă: https://reactivi.ro/produs/anti-atp6v0c-antibody-arc61235/ · actualizat 9 septembrie 2026