# Anti-Asparagine synthetase Antibody \[ARC0517\]

**Cod produs:** A305812 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Asparagine synthetase Antibody [ARC0517] este un anticorp monoclonal de iepure împotriva țintei Asparagine Synthetase, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Asparagine Synthetase |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 64 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC0517 |
| Secvență | ETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSAR |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ASNS (P08243). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305812-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC0517] antibody to Asparagine synthetase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305812.pdf)

---

Sursă: https://reactivi.ro/produs/anti-asparagine-synthetase-antibody-arc0517/ · actualizat 9 septembrie 2026