# Anti-Angiotensin II Type 1 Receptor Antibody

**Cod produs:** A90187 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Angiotensin II Type 1 Receptor Antibody este un anticorp policlonal de iepure împotriva țintei Angiotensin II Type 1 Receptor, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Angiotensin II Type 1 Receptor |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 62 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | LIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 294-388 of human AT1R/AGTR1 (NP_114438.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A90187-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Angiotensin II Type 1 Receptor.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/90/A90187.pdf)

---

Sursă: https://reactivi.ro/produs/anti-angiotensin-ii-type-1-receptor-antibody-2/ · actualizat 9 septembrie 2026