# Anti-68kDa Neurofilament (9-88)/NF-L (9-88) Antibody \[DM198\] (Biotin)

**Cod produs:** A332504 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-68kDa Neurofilament (9-88)/NF-L (9-88) Antibody [DM198] (Biotin) este un anticorp monoclonal de iepure împotriva țintei 68kDa Neurofilament (9-88)/NF-L (9-88), cu reactivitate declarată pentru Human. Este validat pentru ELISA, are izotipul IgG și este conjugat cu Biotin. Se livrează în mărimile 100µg și 500µg, la prețuri între 7.453,60 și 21.828,40 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | 68kDa Neurofilament (9-88)/NF-L (9-88) |
| Applications | ELISA |
| Reactivity | Human |
| Conjugate | Biotin |
| Formulation | Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%–8% Trehalose is added as a protectant before lyophilization. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purification | Affinity-chromatography |
| Isotype | IgG |
| Recommended dilutions | ELISA: 1:5,000 - 1:10,000 |
| Reconstitution | Reconstitute with distilled sterile water. |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C. Reconstituted: Aliquot and store at -80°C. Product is stable for one year. Avoid freeze/thaw cycles. |
| Clonă | DM198 |
| Secvență | YYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRT |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A332504-100 · 7.453,60 lei |
| 500µg | A332504-500 · 21.828,40 lei |

## Descriere

Recombinant rabbit monoclonal [DM198] antibody to 68kDa Neurofilament (9-88)/NF-L (9-88) (Biotin).

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/332/A332504.pdf)

---

Sursă: https://reactivi.ro/produs/anti-68kda-neurofilament-9-88-nf-l-9-88-antibody-dm198-biotin/ · actualizat 9 septembrie 2026
